Peroxiredoxin 4/PRDX4 Antibody

• Catalog Number: orb251566
• Category: Antibodies
• Description: Peroxiredoxin 4/PRDX4 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry , 0.5-1μg/ml, Human, - Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 30540 MW
• UniProt ID: Q13162
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Peroxiredoxin-4;1.11.1.15;Antioxidant enzyme AOE37
• Note: For research use only
• Application notes: WB: The detection limit for Peroxiredoxin 4 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

IHC(P) analysis of Mouse Brain Tissue using Anti-Peroxiredoxin 4 Picoband antibody.

IHC(P) analysis of Rat Brain Tissue using Anti-Peroxiredoxin 4 Picoband antibody.

IHC(P) analysis of Human Tonsil Tissue using Anti-Peroxiredoxin 4 Picoband antibody.

Flow Cytometry analysis of MCF-7 cells using anti-Peroxiredoxin 4 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Western blot analysis using Anti-Peroxiredoxin 4 Picoband antibody.Lane 1:Rat Brain Tissue;2:Mouse Brain Tissue;3:HELA Cell.

IF analysis of Peroxiredoxin 4 using anti-Peroxiredoxin 4 antibody. Peroxiredoxin 4 was detected in immunocytochemical section of A549 cells.

IHC analysis of Peroxiredoxin 4 using anti-Peroxiredoxin 4 antibody.Peroxiredoxin 4 was detected in immunocytochemical section of A549 Cell.