Periplakin/PPL Antibody

• Catalog Number: orb389507
• Category: Antibodies
• Description: Periplakin/PPL Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Periplakin (1664-1701aa DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK), different from the related mouse sequence by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.25 μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 2-5 μg/ml, Human Immunocytochemistry/Immunofluorescence, 5 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 204747 MW
• UniProt ID: O60437
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Periplakin;190 kDa paraneoplastic pemphigus antige
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U20S cells using anti-Periplakin antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of Periplakin using anti-Periplakin antibody.Lane 1:human HeLa cell; 2:human A549 cell; 3:human SW620 cell; 4:human HepG2 cell; 5:human SK-OV-3 cell;6:human PANC-1 cell; 7:human SGC-7801 cell; 8:rat lung tissue; 9:mouse lung tissue.

IF analysis of Periplakin using anti-Periplakin antibody. Periplakin was detected in immunocytochemical section of A431 cells.

IHC analysis of Periplakin using anti-Periplakin antibody. Periplakin was detected in a paraffin-embedded section of human lung cancer tissue.

IHC analysis of Periplakin using anti-Periplakin antibody. Periplakin was detected in a paraffin-embedded section of human oesophagus squama cancer tissue.

IHC analysis of Periplakin using anti-Periplakin antibody. Periplakin was detected in a paraffin-embedded section of human tonsil tissue.