You have no items in your shopping cart.
Cart summary
PDPK1 Peptide - N-terminal region
Catalog Number: orb1997795
| Catalog Number | orb1997795 |
|---|---|
| Category | Proteins |
| Description | PDPK1 Peptide - N-terminal region |
| Predicted Reactivity | Mouse |
| Form/Appearance | Lyophilized powder |
| MW | 61 kDa |
| UniProt ID | Q9Z2A0 |
| Protein Sequence | Synthetic peptide located within the following region: NPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAI |
| NCBI | NP_035192.2 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | Pdk1 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
