PDPK1 Antibody

• Catalog Number: orb316598
• Category: Antibodies
• Description: PDPK1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PDPK1 (524-556aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ), different from the related mouse and rat sequences by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By HeatImmunohistochemistry (Frozen Section), 0.5-1μg/ml Western blot, 0.1-0.5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 63152 MW
• UniProt ID: O15530
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: 3-phosphoinositide-dependent protein kinase 1;hPDK
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of PDPK1 using anti-PDPK1 antibody.Lane 1:Rat Liver Tissue;2:Rat Lung Tissue;3:Mouse Liver Tissue;4:Mouse Lung Tissue;5:COLO320 Cell;6:MCF-7 Cell.

IHC analysis of PDPK1 using anti-PDPK1 antibody.PDPK1 was detected in paraffin-embedded section of Mouse Intestine Tissue.

IHC analysis of PDPK1 using anti-PDPK1 antibody.PDPK1 was detected in paraffin-embedded section of Rat Testis Tissue.

IHC analysis of PDPK1 using anti-PDPK1 antibody.PDPK1 was detected in paraffin-embedded section of Human Lung Cancer Tissue.

IHC analysis of PDPK1 using anti-PDPK1 antibody.PDPK1 was detected in frozen section of mouse small intestine tissue.

IHC analysis of PDPK1 using anti-PDPK1 antibody.PDPK1 was detected in frozen section of human placenta tissue.