PDHB monoclonal antibody (M03), clone 2B2

• Catalog Number: orb2292432
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PDHB.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PDHB (NP_000916, 250 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: LEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 2B2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_000916

Detection limit for recombinant GST tagged PDHB is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to PDHB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]

PDHB monoclonal antibody (M03), clone 2B2 Western Blot analysis of PDHB expression in HeLa.

Western Blot analysis of PDHB expression in transfected 293T cell line by PDHB monoclonal antibody (M03), clone 2B2. Lane 1: PDHB transfected lysate (39.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).