PDCD6IP monoclonal antibody (M01), clone 3C4

• Catalog Number: orb2291636
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PDCD6IP.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PDCD6IP (AAH20066, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVK
• Tested applications: ELISA, IF, WB
• Clone Number: 3C4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH20066

Detection limit for recombinant GST tagged PDCD6IP is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PDCD6IP on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (37.73 KDa).