PCSK1N monoclonal antibody (M02), clone 1E9

• Catalog Number: orb2291228
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PCSK1N.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PCSK1N (NP_037403.1, 173 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: DGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 1E9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_037403.1
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PCSK1N is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PCSK1N on HeLa cell. [antibody concentration 20 ug/ml]

Immunoperoxidase of monoclonal antibody to PCSK1N on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]

Western Blot analysis of PCSK1N expression in transfected 293T cell line by PCSK1N monoclonal antibody (M02), clone 1E9. Lane 1: PCSK1N transfected lysate (Predicted MW: 27.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.42 KDa).