You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291228 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant PCSK1N. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | PCSK1N (NP_037403.1, 173 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | DGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 1E9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_037403.1 |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged PCSK1N is 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to PCSK1N on HeLa cell. [antibody concentration 20 ug/ml]
Immunoperoxidase of monoclonal antibody to PCSK1N on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]
Western Blot analysis of PCSK1N expression in transfected 293T cell line by PCSK1N monoclonal antibody (M02), clone 1E9. Lane 1: PCSK1N transfected lysate (Predicted MW: 27.4 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.42 KDa).