You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292442 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant PCNA. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1G7 |
Tested applications | ELISA, IF, IP, WB |
Reactivity | Human |
Isotype | IgG2a kappa |
Immunogen | PCNA (AAH00491, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS |
NCBI | AAH00491 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged PCNA is approximately 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to PCNA on HeLa cell. [antibody concentration 10 ug/ml]
Immunoprecipitation of PCNA transfected lysate using anti-PCNA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PCNA MaxPab rabbit polyclonal antibody.
PCNA monoclonal antibody (M02), clone 1G7 Western Blot analysis of PCNA expression in Hela.
Western Blot analysis of PCNA expression in transfected 293T cell line by PCNA monoclonal antibody (M02), clone 1G7. Lane 1: PCNA transfected lysate (28.8 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (54.45 KDa).