PCGF3 Rabbit Polyclonal Antibody

• Catalog Number: orb575074
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PCGF3
• Target: PCGF3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCGF3
• Protein Sequence: Synthetic peptide located within the following region: FYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEED
• UniProt ID: Q3KNV8
• MW: 28kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RNF3, DONG1, RNF3A
• Note: For research use only
• NCBI: NP_006306

Sample Type: Fetal Muscle lysates, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-PCGF3 Antibody Titration: 0.125 ug/ml, ELISA Titer: 1:12500, Positive Control: Raji cell lysate, PCGF3 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells.