PCDHGA10 Antibody

• Catalog Number: orb2236261
• Category: Antibodies
• Description: PCDHGA10 Antibody
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3A7
• Tested applications: ELISA, WB
• Isotype: IgG2a Kappa
• Immunogen: PCDHGA10 (NP_061736.1, 219 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Form/Appearance: Liquid
• Conjugation: Unconjugated
• Protein Sequence: SDGGDPLRSGTVLVSVTVFDANDNAPVFTLPEYRVSVPENLPVGTQLLTVTATDRDEGANGEVTYSFRKLPDTQLLKFQLNKYTGEIKISENLDYEET
• NCBI: NP_061736.1
• Storage: Store at -2°C or lower. Aliquot to avoid repeated freezing and thawing.
• Buffer/Preservatives: Liquid
• Alternative names: PCDH-GAMMA-A10;protocadherin gamma-A10.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.