PCDH15 Antibody

• Catalog Number: orb526999
• Category: Antibodies
• Description: PCDH15 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human PCDH15 (DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry, 0.5-1μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 190 kDa
• UniProt ID: Q96QU1
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Protocadherin-15; PCDH15; USH1F
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U-87MG cells using anti-PCDH15 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis anti-PCDH15 antibody.Lane 1:human placenta Tissue;2:human U2OS Cell;3:human HeLa Cell;4:rat brain Tissue;5:rat lung Tissue;6:mouse brain Tissue;7:mouse lung Tissue;8:mouse kidney Tissue;9:mouse spleen Tissue;10:mouse Neuro-2a Cell.

IHC analysis of PCDH15 using anti-PCDH15 antibody.PCDH15 was detected in paraffin-embedded section of human skeletal muscle tissues.

IHC analysis of PCDH15 using anti-PCDH15 antibody.PCDH15 was detected in paraffin-embedded section of human prostatic cancer tissues.

IHC analysis of PCDH15 using anti-PCDH15 antibody.PCDH15 was detected in paraffin-embedded section of human rectal cancer tissues.

IHC analysis of PCDH15 using anti-PCDH15 antibody.PCDH15 was detected in paraffin-embedded section of human tonsil tissues.

IHC analysis of PCDH15 using anti-PCDH15 antibody.PCDH15 was detected in paraffin-embedded section of mouse brain tissues.

IHC analysis of PCDH15 using anti-PCDH15 antibody.PCDH15 was detected in paraffin-embedded section of mouse spleen tissues.

IHC analysis of PCDH15 using anti-PCDH15 antibody.PCDH15 was detected in paraffin-embedded section of rat brain tissues.

IHC analysis of PCDH15 using anti-PCDH15 antibody.PCDH15 was detected in paraffin-embedded section of rat spleen tissues.