PCDH1 monoclonal antibody (M01), clone 5D5

• Catalog Number: orb2292447
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PCDH1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5D5
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: PCDH1 (NP_002578, 62 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFA
• NCBI: NP_002578
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PCDH1 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PCDH1 on A-431 cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to PCDH1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]

PCDH1 monoclonal antibody (M01), clone 5D5 Western Blot analysis of PCDH1 expression in A-431.

Western Blot detection against Immunogen (37.62 KDa).