You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292452 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant PCBP1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1G2 |
Tested applications | ELISA, IF, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | PCBP1 (AAH39742, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT |
NCBI | AAH39742 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged PCBP1 is 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to PCBP1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of PCBP1 expression in transfected 293T cell line by PCBP1 monoclonal antibody (M01), clone 1G2. Lane 1: PCBP1 transfected lysate (37.5 KDa). Lane 2: Non-transfected lysate.