You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
PCBP1 monoclonal antibody (M01), clone 1G2
Catalog Number: orb2292452
| Catalog Number | orb2292452 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant PCBP1. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 1G2 |
| Tested applications | ELISA, IF, WB |
| Reactivity | Human |
| Isotype | IgG2a Kappa |
| Immunogen | PCBP1 (AAH39742, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT |
| NCBI | AAH39742 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged PCBP1 is 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to PCBP1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of PCBP1 expression in transfected 293T cell line by PCBP1 monoclonal antibody (M01), clone 1G2. Lane 1: PCBP1 transfected lysate (37.5 KDa). Lane 2: Non-transfected lysate.
