PBP/PEBP1 Antibody

• Catalog Number: orb413076
• Category: Antibodies
• Description: PBP/PEBP1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IHC, WB
• Reactivity: Human, Mouse
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human PBP (DHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQ).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 21 kDa
• UniProt ID: P30086
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Phosphatidylethanolamine-binding protein 1; PEBP-1
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HepG2 cells using anti-PBP antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of PBP using anti-PBP antibody.Lane 1:human HeLa cell; 2:human MCF-7 cell; 3:human HepG2 cell; 4:human 293T cell; 5:mouse testis lysates.

IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human sarcoma tissue.

IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of mouse kidney tissue.

IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human liver cancer tissue.

IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human mammary cancer tissue.

IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human endometrial carcinoma tissue.

IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human tonsil tissue.

IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of mouse brain tissue.

IHC analysis of PBP using anti-PBP antibody.PBP was detected in paraffin-embedded section of human pancreatic cancer tissue.