PAX2 monoclonal antibody (M01), clone 3C7

• Catalog Number: orb2292459
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PAX2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3C7
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: PAX2 (NP_000269, 194 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP
• NCBI: NP_000269
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PAX2 is 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to PAX2 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 0.5 ug/ml]

Western Blot analysis of PAX2 expression in transfected 293T cell line by PAX2 monoclonal antibody (M01), clone 3C7. Lane 1: PAX2 transfected lysate (47.41 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).