PARP4 polyclonal antibody (A01)

• Catalog Number: orb2296332
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant PARP4.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: ELISA, WB
• Reactivity: Human
• Immunogen: PARP4 (NP_006428, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag.
• Conjugation: Unconjugated
• Protein Sequence: KENGGKFSFSLNPQCTHIILDNADVLSQYQLNSIQKNHVHIANPDFIWKSIREKRLLDVKNYDPYKPLDITPPPDQKASSSEVKTEGLCPDSATEEEDTVELTEFGMQNV
• NCBI: NP_006428
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: 50 % glycerol
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot detection against Immunogen (38.21 KDa).