PARK2 monoclonal antibody (M01), clone 1H4

• Catalog Number: orb2292460
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PARK2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1H4
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Rat
• Isotype: IgG3 Kappa
• Immunogen: PARK2 (AAH22014, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK
• NCBI: AAH22014
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PARK2 is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PARK2 on HeLa cell. [antibody concentration 10 ug/ml]

PARK2 monoclonal antibody (M01), clone 1H4. Western Blot analysis of PARK2 expression in PC-12.

Western Blot detection against Immunogen (36.74 KDa).