PAR2/F2RL1 Antibody

• Catalog Number: orb316563
• Category: Antibodies
• Description: PAR2/F2RL1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PAR2 (349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 44126 MW
• UniProt ID: P55085
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Proteinase-activated receptor 2;PAR-2;Coagulation
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of PAR2 using anti-PAR2 antibody.Lane 1:HELA Cell;2:COLO320 Cell;3:SW620 Cell;4:HEPG2 Cell.