You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb316563 |
---|---|
Category | Antibodies |
Description | PAR2/F2RL1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human PAR2 (349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 44126 MW |
UniProt ID | P55085 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Proteinase-activated receptor 2;PAR-2;Coagulation Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of PAR2 using anti-PAR2 antibody.Lane 1:HELA Cell;2:COLO320 Cell;3:SW620 Cell;4:HEPG2 Cell.
Filter by Rating