You have no items in your shopping cart.
Cart summary
Pal Protein, Pasteurella multocida, Recombinant (His & SUMO)
Catalog Number: orb1976834
| Catalog Number | orb1976834 |
|---|---|
| Category | Proteins |
| Description | Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. Pal Protein, Pasteurella multocida, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 27.3 kDa and the accession number is Q51886. |
| Tag | N-6xHis-SUMO |
| Purity | 91.00% |
| Protein Sequence | CGSSKKDESAGQMFGGYSVQDLQQRYNTVYFGFDKYNIEGEYVQILDAHAAFLNATPATKVVVEGNTDERGTPEYNIALGQRRADAVKHYLSAKGVQAGQVSTVSYGEEKPAVLGHDEAAYSKNRRAVLAY |
| UniProt ID | Q51886 |
| MW | 27.3 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Pasteurella multocida |
| Biological Activity | Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. Pal Protein, Pasteurella multocida, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 27.3 kDa and the accession number is Q51886. |
| Expression Region | 20-150 aa |
| Storage | -20°C |
| Note | For research use only |
