Pal Protein, Legionella pneumophila, Recombinant (E. coli, His)

• Catalog Number: orb1977521
• Category: Proteins
• Description: Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. Very strongly associated with the peptidoglycan.
• Tag: N-6xHis
• Purity: 96.00%
• Protein Sequence: CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR
• UniProt ID: P26493
• MW: 20.8 kDa (predicted)
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expression System: E. coli
• Biological Origin: Legionella pneumophila
• Biological Activity: Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. Very strongly associated with the peptidoglycan.
• Expression Region: 22-176 aa
• Storage: -20°C
• Note: For research use only