You have no items in your shopping cart.
Cart summary
Pal Protein, E. coli, Recombinant (His & Myc)
Catalog Number: orb1979210
| Catalog Number | orb1979210 |
|---|---|
| Category | Proteins |
| Description | Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. The Tol-Pal system is also required for polar localization of chemoreceptors clusters. The system also appears to be required for the activity of several outer membrane-localized enzymes with cell wall remodeling activity. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| Protein Sequence | CSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY |
| UniProt ID | P0A912 |
| MW | 24.1 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | E. coli |
| Biological Activity | Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. The Tol-Pal system is also required for polar localization of chemoreceptors clusters. The system also appears to be required for the activity of several outer membrane-localized enzymes with cell wall remodeling activity. |
| Expression Region | 22-173 aa |
| Storage | -20°C |
| Note | For research use only |
