You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb316596 |
---|---|
Category | Antibodies |
Description | PAK5/PAK7 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human PAK5 (26-55aa DPQEQKFTGLPQQWHSLLADTANRPKPMVD), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 80745 MW |
UniProt ID | Q9P286 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Serine/threonine-protein kinase PAK 7;2.7.11.1;p21 Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of PAK5 using anti-PAK5 antibody.Lane 1:human SH-SY5Y cell; 2:rat brain tissue; 3:mouse brain tissue.
IHC analysis of PAK5 using anti-PAK5 antibody. PAK5 was detected in a paraffin-embedded section of human glioma tissue.
IHC-P | |
Canine, Equine, Human, Mouse, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P | |
Canine, Equine, Human, Mouse, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
HRP |
ELISA, IHC-P | |
Canine, Equine, Human, Mouse, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Filter by Rating