You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292464 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant PAK1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | PAK1 (NP_002567, 191 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA |
Tested applications | ELISA, IF, IHC-P, IP, WB |
Clone Number | 4D1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_002567 |
Detection limit for recombinant GST tagged PAK1 is approximately 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to PAK1 on HeLa cell. [antibody concentration 35 ug/ml]
Immunoperoxidase of monoclonal antibody to PAK1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
Immunoprecipitation of PAK1 transfected lysate using anti-PAK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PAK1 monoclonal antibody.
Western Blot analysis of PAK1 expression in transfected 293T cell line by PAK1 monoclonal antibody (M02), clone 4D1. Lane 1: PAK1 transfected lysate (Predicted MW: 49.6 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.53 KDa).