You have no items in your shopping cart.
Page Not Found
Cart summary
PAG-2 Protein, Bovine, Recombinant (His)
Catalog Number: orb1979615
| Catalog Number | orb1979615 |
|---|---|
| Category | Proteins |
| Description | PAG2 or a processed derivative of this molecule might represent a factor that binds the LH receptor. PAG-2 Protein, Bovine, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 43.6 kDa and the accession number is Q28057. |
| Tag | N-6xHis |
| Purity | 98.00% |
| Protein Sequence | KKMKTLRETLREKNLLNNFLEEQAYRLSKNDSKITIHPLRNYLDTAYVGNITIGTPPQEFRVVFDTGSANLWVPCITCTSPACYTHKTFNPQNSSSFREVGSPITIFYGSGIIQGFLGSDTVRIGNLVSPEQSFGLSLEEYGFDSLPFDGILGLAFPAMGIEDTIPIFDNLWSHGAFSEPVFAFYLNTNKPEGSVVMFGGVDHRYYKGELNWIPVSQTSHWQISMNNISMNGTVTACSCGCEALLDTGTSMIYGPTKLVTNIHKLMNARLENSEYVVSCDAVKTLPPVIFNINGIDYPLRPQAYIIKIQNSCRSVFQGGTENSSLNTWILGDIFLRQYFSVFDRKNRRIGLAPAV |
| UniProt ID | Q28057 |
| MW | 43.6 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | Bovine |
| Biological Activity | PAG2 or a processed derivative of this molecule might represent a factor that binds the LH receptor. PAG-2 Protein, Bovine, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 43.6 kDa and the accession number is Q28057. |
| Expression Region | 22-376 aa |
| Storage | -20°C |
| Note | For research use only |
