PAFAH1B1 monoclonal antibody (M03), clone 5A5

• Catalog Number: orb2292468
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PAFAH1B1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PAFAH1B1 (NP_000421, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSP
• Tested applications: ELISA, IF, WB
• Clone Number: 5A5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_000421
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged PAFAH1B1 is 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to PAFAH1B1 on HeLa cell. [antibody concentration 15 ug/ml]

Western Blot analysis of PAFAH1B1 expression in transfected 293T cell line by PAFAH1B1 monoclonal antibody (M03), clone 5A5. Lane 1: PAFAH1B1 transfected lysate (46.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).