p95 NBS1/NBN Antibody

• Catalog Number: orb312141
• Category: Antibodies
• Description: p95 NBS1/NBN Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC, WB
• Predicted Reactivity: Bovine
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human p95 NBS1 (714-745aa RKNTELEEWLRQEMEVQNQHAKEESLADDLFR), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat Immunocytochemistry, 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 5 μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 84959 MW
• UniProt ID: O60934
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Nibrin;Cell cycle regulatory protein p95;Nijmegen
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of p95 NBS1 using anti-p95 NBS1 antibody.Lane 1:human HeLa cell;2:human U20S cell;3:human K562 cell;4:rat PC-12 cell;5:mouse testis tissue;6:mouse NIH/3T3 cell.

IF analysis of p95 NBS1 and Tubulin beta using anti-p95 NBS1 antibody and anti-Tubulin beta antibody.p95 NBS1 and Tubulin beta were detected in immunocytochemical section of U20S cells.

IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in a paraffin-embedded section of human breast cancer tissue.

IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in a paraffin-embedded section of human breast cancer tissue.

IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in a paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in a paraffin-embedded section of mouse intestine tissue.

IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in a paraffin-embedded section of rat intestine tissue.

IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody.p95 NBS1 was detected in immunocytochemical section of SW480 cell.

IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in immunocytochemical section of A549 cell.

IHC analysis of p95 NBS1 using anti-p95 NBS1 antibody. p95 NBS1 was detected in immunocytochemical section of SMMC-7721 cell.