P2RY1 monoclonal antibody (M01), clone 4C2

• Catalog Number: orb2292472
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant P2RY1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4C2
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: P2RY1 (NP_002554, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFY
• NCBI: NP_002554
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged P2RY1 is approximately 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to P2RY1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (31.46 KDa).