P2RX4 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2292474
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human P2RX4 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: FC, WB
• Reactivity: Human
• Immunogen: P2RX4 (NP_002551.2, 1 a.a. ~ 388 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ
• NCBI: NP_002551.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

FACS analysis of negative control 293 cells (Black) and P2RX4 expressing 293 cells (Green) using P2RX4 purified MaxPab mouse polyclonal antibody.

Western Blot analysis of P2RX4 expression in transfected 293T cell line by P2RX4 MaxPab polyclonal antibody. Lane 1: P2RX4 transfected lysate (42.68 KDa). Lane 2: Non-transfected lysate.