P Glycoprotein/ABCB1 Antibody

• Catalog Number: orb234261
• Category: Antibodies
• Description: P Glycoprotein/ABCB1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein (621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Mouse, Rat, -Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 141479 MW
• UniProt ID: P08183
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Multidrug resistance protein 1;3.6.3.44;ATP-bindin
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

IHC(F) analysis of Mouse Intestine Tissue using Anti-P Glycoprotein Picoband antibody.

IHC(F) analysis of Rat Kidney Tissue using Anti-P Glycoprotein Picoband antibody.

IHC(P) analysis of Human Lung Cancer Tissue using Anti-P Glycoprotein Picoband antibody.

IHC(P) analysis of Mouse Kidney Tissue using Anti-P Glycoprotein Picoband antibody.

IHC(P) analysis of Rat Kidney Tissue using Anti-P Glycoprotein Picoband antibody.