You have no items in your shopping cart.
Cart summary
OXT Protein, Human, Recombinant (His & Myc & SUMO)
Catalog Number: orb1978095
| Catalog Number | orb1978095 |
|---|---|
| Category | Proteins |
| Description | Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 29.6 kDa and the accession number is P01178. |
| Tag | N-10xHis-SUMO, C-Myc |
| Purity | 98.00% |
| MW | 29.6 kDa (predicted) |
| UniProt ID | P01178 |
| Protein Sequence | AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 29.6 kDa and the accession number is P01178. |
| Expression Region | 32-125 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
