You have no items in your shopping cart.
Cart summary
OX40L/TNFSF4 Protein, Rabbit, Recombinant (His & Myc)
Catalog Number: orb1976706
| Catalog Number | orb1976706 |
|---|---|
| Category | Proteins |
| Description | Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. TNFSF4 Protein, Rabbit, Recombinant (His & Myc) is expressed in yeast with C-6xHis, Myc tag. The predicted molecular weight is 19.8 kDa and the accession number is O02765. |
| Tag | C-6xHis, Myc |
| Purity | 98.00% |
| MW | 19.8 kDa (predicted) |
| UniProt ID | O02765 |
| Protein Sequence | QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Rabbit |
| Biological Activity | Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. TNFSF4 Protein, Rabbit, Recombinant (His & Myc) is expressed in yeast with C-6xHis, Myc tag. The predicted molecular weight is 19.8 kDa and the accession number is O02765. |
| Expression Region | 45-187 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
