You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2052397 |
---|---|
Category | Proteins |
Description | OSM34 Recombinant Protein (Mouse-ear cress) |
Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 44.4 kDa |
UniProt ID | P50700 |
Protein Sequence | ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGSHQLPIKMVTEEN |
Source | E.coli |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | AT4G11650;ATOSM34;osmotin 34;T5C23.80;T5C23_80. Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
44.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
44.4 kDa | |
E.coli |
Filter by Rating