Cart summary

You have no items in your shopping cart.

OSBPL11 Peptide - N-terminal region

OSBPL11 Peptide - N-terminal region

Catalog Number: orb1999343

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1999343
CategoryProteins
DescriptionOSBPL11 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: KNSSCGGGISSSSSSRGGSAKGWQYSDHMENVYGYLMKYTNLVTGWQYRF
UniProt IDQ9BXB4
MW82 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesORP11, ORP-11, OSBP12, TCCCIA00292
NoteFor research use only
NCBINP_073613.2