OPRK1 polyclonal antibody (A01)

• Catalog Number: orb2292478
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant OPRK1.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: ELISA, WB
• Reactivity: Human, Rat
• Immunogen: OPRK1 (NP_000903, 1 a.a. ~ 58 a.a) partial recombinant protein with GST tag.
• Conjugation: Unconjugated
• Protein Sequence: MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAI
• NCBI: NP_000903
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: 50 % glycerol
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

OPRK1 polyclonal antibody (A01), Western Blot analysis of OPRK1 expression in human ovarian cancer.

OPRK1 polyclonal antibody (A01). Western Blot analysis of OPRK1 expression in rat kidney.

Western Blot detection against Immunogen (32.49 KDa).