Onecut1 Rabbit Polyclonal Antibody

SKU: orb573980

Description

Rabbit polyclonal antibody to Onecut1

Research Area

Cell Biology, Epigenetics & Chromatin, Neuroscience, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Onecut1
• Protein Sequence: Synthetic peptide located within the following region: CKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITIS
• Molecular Weight: 51kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Oc, HNF, OC-, Oc1, Hnf6, OC-1, HNF-6, Hfh12, Hnf6b, D9Ertd423, D9Ertd423e

Sample Type: Frozen section of mouse embryo at et12.5, Primary dilution: 1:500, Secondary dilution: 1:2000, Antigen Retrevial method: Citrate buffer (pH=6).

Immunohistochemistry with mouse embryo tissue.

Onecut1 antibody - C-terminal region (orb573980) validated by WB using Mouse Liver lysate at 1.0 ug/ml.

Quick Database Links

Gene Symbol

Onecut1

UniProt

O08755

RefSeq (Protein):NP_032288