You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1979236 |
---|---|
Category | Proteins |
Description | OmpX Protein, E. coli O157:H7, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 23.8 kDa and the accession number is P0A919. |
Tag | N-10xHis, C-Myc |
Purity | 98.00% |
Protein Sequence | ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF |
UniProt ID | P0A919 |
MW | 23.8 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | E. coli |
Biological Origin | E. coli |
Biological Activity | N/A. OmpX Protein, E. coli O157:H7, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 23.8 kDa and the accession number is P0A919. |
Expression Region | 24-171 aa |
Storage | -20°C |
Note | For research use only |