OGT/O-Linked N-Acetylglucosamine Transferase Antibody

• Catalog Number: orb334499
• Category: Antibodies
• Description: OGT/O-Linked N-Acetylglucosamine Transferase Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Bovine, Equine, Monkey, Rabbit
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human, Mouse
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 116925 MW
• UniProt ID: O15294
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: UDP-N-acetylglucosamine--peptide N-acetylglucosami
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U937 cells using anti-OGT antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of RAW264.7 cells using anti-OGT antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of OGT using anti-OGT antibody.Lane 1:human HeLa cell; 2:human PC-3 cell; 3:human A431 cell; 4:human A549 cell;5:human Caco-2 cell;6:human K562 cell;7:rat heart tissue;8:mouse heart tissue.

IF analysis of OGT using anti-OGT antibody. OGT was detected in immunocytochemical section of A431 cell.

IHC analysis of OGT using anti-OGT antibody. OGT was detected in a paraffin-embedded section of rat intestine tissue.

IHC analysis of OGT using anti-OGT antibody. OGT was detected in a paraffin-embedded section of mouse intestine tissue.

IHC analysis of OGT using anti-OGT antibody. OGT was detected in paraffin-embedded section of human gastric cancer tissue.

IHC analysis of OGT using anti-OGT antibody. OGT was detected in paraffin-embedded section of human pancreatic cancer tissue.

IHC analysis of OGT using anti-OGT antibody. OGT was detected in paraffin-embedded section of rat pancreas tissue.