You have no items in your shopping cart.
Cart summary
Odorant-binding Protein, Bovine, Recombinant (His & SUMOstar)
Catalog Number: orb1979619
| Catalog Number | orb1979619 |
|---|---|
| Category | Proteins |
| Description | This protein binds a wide variety of chemical odorants. Odorant-binding Protein, Bovine, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 34.5 kDa and the accession number is P07435. |
| Tag | N-6xHis-SUMOstar |
| Purity | 98.00% |
| MW | 34.5 kDa (predicted) |
| UniProt ID | P07435 |
| Protein Sequence | AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Bovine |
| Biological Activity | This protein binds a wide variety of chemical odorants. Odorant-binding Protein, Bovine, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 34.5 kDa and the accession number is P07435. |
| Expression Region | 1-159 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
