You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291063 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant ODAM. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2F8 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | ODAM (AAH17796.1, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP |
NCBI | AAH17796.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged ODAM is 0.1 ng/ml as a capture antibody.
Western Blot analysis of ODAM expression in transfected 293T cell line by ODAM monoclonal antibody (M02), clone 2F8. Lane 1: ODAM transfected lysate (Predicted MW: 17.4 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (43.8 KDa).