OCIAD1 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2291065
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human OCIAD1 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: OCIAD1 (AAH03409, 1 a.a. ~ 245 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE
• NCBI: AAH03409
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

OCIAD1 MaxPab polyclonal antibody. Western Blot analysis of OCIAD1 expression in human pancreas.

Western Blot analysis of OCIAD1 expression in transfected 293T cell line by OCIAD1 MaxPab polyclonal antibody. Lane 1: OCIAD1 transfected lysate(27.06 KDa). Lane 2: Non-transfected lysate.