You have no items in your shopping cart.
Cart summary
Item 1 of 1
NXT1 purified MaxPab rabbit polyclonal antibody (D01P)
Catalog Number: orb2291213
| Catalog Number | orb2291213 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody raised against a full-length human NXT1 protein. |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | NXT1 (AAH00759.1, 1 a.a. ~ 140 a.a) full-length human protein. |
| Protein Sequence | MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | AAH00759.1 |
Western Blot analysis of NXT1 expression in transfected 293T cell line by NXT1 MaxPab polyclonal antibody. Lane 1: NXT1 transfected lysate(15.51 KDa). Lane 2: Non-transfected lysate.
