NXF5 Rabbit Polyclonal Antibody

SKU: orb577886

Description

Rabbit polyclonal antibody to NXF5

Research Area

Epigenetics & Chromatin, Molecular Biology, Protein Biochemistry

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Canine, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NXF5
• Target: NXF5
• Protein Sequence: Synthetic peptide located within the following region: ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE
• Molecular Weight: 44kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Lanes: Lane 1: 7 ug HeLa cystosolic extract, Lane 2: 7 ug HeLa nuclear extract, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:500, Gene Name: NXF5.

Rabbit Anti-NXF5 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-NXF5 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-NXF5 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

NXF5

UniProt

Q9H1B4

RefSeq (Protein):NP_116564