NUP133 monoclonal antibody (M01), clone 3E8

• Catalog Number: orb2291008
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NUP133.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3E8
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: NUP133 (NP_060700, 1069 a.a. ~ 1155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ
• NCBI: NP_060700
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NUP133 is 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to NUP133 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]

NUP133 monoclonal antibody (M01), clone 3E8 Western Blot analysis of NUP133 expression in HeLa.

Western Blot detection against Immunogen (35.31 KDa).