NUMA1 monoclonal antibody (M01), clone 1C5

• Catalog Number: orb2292487
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NUMA1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: NUMA1 (NP_006176, 200 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: SPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQDLKTEK
• Tested applications: ELISA, IP, WB
• Clone Number: 1C5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_006176
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NUMA1 is approximately 0.1 ng/ml as a capture antibody.

Immunoprecipitation of NUMA1 transfected lysate using anti-NUMA1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NUMA1 MaxPab rabbit polyclonal antibody.

NUMA1 monoclonal antibody (M01), clone 1C5 Western Blot analysis of NUMA1 expression in K-562.

Western Blot detection against Immunogen (37.51 KDa).