NUDT21 monoclonal antibody (M12), clone 3F8

• Catalog Number: orb2291456
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant NUDT21.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F8
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: NUDT21 (AAH01403, 1 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
• NCBI: AAH01403
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NUDT21 is approximately 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to NUDT21 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to NUDT21 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (50.71 KDa).