NUDT2 monoclonal antibody (M01), clone 4A4-3C3

• Catalog Number: orb2296026
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant NUDT2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4A4-3C3
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: NUDT2 (AAH04926, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
• NCBI: AAH04926
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged NUDT2 is approximately 0.3 ng/ml as a capture antibody.

NUDT2 monoclonal antibody (M01), clone 4A4-3C3 Western Blot analysis of NUDT2 expression in Jurkat.

Western Blot analysis of NUDT2 expression in transfected 293T cell line by NUDT2 monoclonal antibody (M01), clone 4A4-3C3. Lane 1: NUDT2 transfected lysate(16.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (41.91 KDa).