You have no items in your shopping cart.
Cart summary
NTRK2 Peptide - C-terminal region
Catalog Number: orb2009731
| Catalog Number | orb2009731 |
|---|---|
| Category | Proteins |
| Description | NTRK2 Peptide - C-terminal region |
| Tested applications | IF, IHC, WB |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| MW | 57kDa |
| UniProt ID | Q8WXJ5 |
| Protein Sequence | DFSWFGFGKVKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPD |
| NCBI | NP_001018075 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | GP145-TrkB, TRKB, trk-B Read more... |
| Note | For research use only |
| Application notes | This is a synthetic peptide designed for use in combination with NTRK2 Rabbit Polyclonal Antibody (orb581341). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Expiration Date | 6 months from date of receipt. |
