You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2053693 |
---|---|
Category | Proteins |
Description | NTF4 Recombinant Protein (Human) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 17.9 kDa |
UniProt ID | P34130 |
Protein Sequence | VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA |
Source | E.coli |
NCBI | NP_006170 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | GLC10;GLC1O;neurotrophic factor 4;neurotrophic fac Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
17.9 kDa | |
E.coli |
> 97% as determined by SDS-PAGE and HPLC. | |
14.1 kDa | |
E.Coli |
Greater than 90% as determined by SDS-PAGE. | |
17.9 kDa | |
E.coli |
Unconjugated | |
95% | |
14.1 kDa | |
Human NT-4, Tag Free (orb1496255) is expressed from E. coli cells. It contains AA Gly 81 - Ala 210 (Accession # P34130-1). |
Filter by Rating