NSE/ENO2 Antibody

• Catalog Number: orb443177
• Category: Antibodies
• Description: NSE/ENO2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human NSE (LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENK).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 5μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 47 kDa
• UniProt ID: P09104
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Gamma-enolase; 2-phospho-D-glycerate hydro-lyase;
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-NSE antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of NSE using anti-NSE antibody.Lane 1:human 22RV1 Cell;2:human U20S Cell;3:human A431 Cell;4:human HepG2 Cell;5:human A549 Cell;6:human SHG-44 Cell;7:rat brain tissue;8:mouse brain tissue.

IF analysis of NSE using anti-NSE antibody. NSE was detected in immunocytochemical section of A431 cells.

IHC analysis of NSE using anti-NSE antibody.NSE was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of NSE using anti-NSE antibody.NSE was detected in paraffin-embedded section of human placenta tissue.

IHC analysis of NSE using anti-NSE antibody.NSE was detected in paraffin-embedded section of rat brain tissue.

IHC analysis of NSE using anti-NSE antibody.NSE was detected in paraffin-embedded section of mouse brain tissue.

IHC analysis of NSE using anti-NSE antibody.NSE was detected in paraffin-embedded section of human pancreatic cancer tissue.