You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291820 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant NRP1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | NRP1 (NP_003864, 22 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHG |
Tested applications | ELISA, IP, WB |
Clone Number | 1B3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_003864 |
Detection limit for recombinant GST tagged NRP1 is approximately 0.03 ng/ml as a capture antibody.
Immunoprecipitation of NRP1 transfected lysate using anti-NRP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NRP1 MaxPab rabbit polyclonal antibody.
NRP1 monoclonal antibody (M05), clone 1B3 Western Blot analysis of NRP1 expression in HeLa.
Western Blot analysis of NRP1 expression in transfected 293T cell line by NRP1 monoclonal antibody (M05), clone 1B3. Lane 1: NRP1 transfected lysate (68.3 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (38.21 KDa).